Lineage for d1h9ba1 (1h9b A:1-181,A:413-426)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 117972Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
  4. 117973Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (10 families) (S)
  5. 118409Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (10 proteins)
  6. 118444Protein Glucose 6-phosphate dehydrogenase, N-terminal domain [51827] (2 species)
  7. 118454Species Leuconostoc mesenteroides [TaxId:1245] [51828] (9 PDB entries)
  8. 118460Domain d1h9ba1: 1h9b A:1-181,A:413-426 [60818]
    Other proteins in same PDB: d1h9ba2

Details for d1h9ba1

PDB Entry: 1h9b (more details), 2.4 Å

PDB Description: active mutant (q365->c) of glucose 6-phosphate dehydrogenase from leuconostoc mesenteroides

SCOP Domain Sequences for d1h9ba1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h9ba1 c.2.1.3 (A:1-181,A:413-426) Glucose 6-phosphate dehydrogenase, N-terminal domain {Leuconostoc mesenteroides}
vseiktlvtffggtgdlakrklypsvfnlykkgylqkhfaivgtarqalnddefkqlvrd
sikdftddqaqaeafiehfsyrahdvtdaasyavlkeaieeaadkfdidgnrifymsvap
rffgtiakylkseglladtgynrlmiekpfgtsydtaaelqndlenafddnqlfridhyl
gXepyermihdtmngd

SCOP Domain Coordinates for d1h9ba1:

Click to download the PDB-style file with coordinates for d1h9ba1.
(The format of our PDB-style files is described here.)

Timeline for d1h9ba1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1h9ba2