Lineage for d1h9aa2 (1h9a A:182-412,A:427-485)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1659008Fold d.81: FwdE/GAPDH domain-like [55346] (4 superfamilies)
    core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1
  4. 1659009Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families) (S)
    N-terminal domain is the classic Rossmann-fold
  5. 1659519Family d.81.1.5: Glucose 6-phosphate dehydrogenase-like [55376] (7 proteins)
    has many additional secondary structures
  6. 1659531Protein Glucose 6-phosphate dehydrogenase [55379] (2 species)
  7. 1659541Species Leuconostoc mesenteroides [TaxId:1245] [55380] (9 PDB entries)
  8. 1659542Domain d1h9aa2: 1h9a A:182-412,A:427-485 [60817]
    Other proteins in same PDB: d1h9aa1
    complexed with nap, so4; mutant

Details for d1h9aa2

PDB Entry: 1h9a (more details), 2.16 Å

PDB Description: complex of active mutant (q365->c) of glucose 6-phosphate dehydrogenase from l. mesenteroides with coenzyme nadp
PDB Compounds: (A:) glucose 6-phosphate 1-dehydrogenase

SCOPe Domain Sequences for d1h9aa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h9aa2 d.81.1.5 (A:182-412,A:427-485) Glucose 6-phosphate dehydrogenase {Leuconostoc mesenteroides [TaxId: 1245]}
kemvqniaalrfgnpifdaawnkdyiknvqvtlsevlgveeragyydtagalldmiqnht
mqivgwlamekpesftdkdiraaknaafnalkiydeaevnkyfvraqygagdsadfkpyl
eeldvpadsknntfiagelqfdlprwegvpfyvrsgkrlaakqtrvdivfkagtfnfgse
qeaceavlsiiidpkgaielklnaksvedafntrtidlgwtvsdedkkntpXgsnfadwn
gvsiawkfvdaisavytadkapletyksgsmgpeasdkllaangdawvfkg

SCOPe Domain Coordinates for d1h9aa2:

Click to download the PDB-style file with coordinates for d1h9aa2.
(The format of our PDB-style files is described here.)

Timeline for d1h9aa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1h9aa1