SCOPe 2.07: Domain d1h99a2: 1h99 A:169-275

Lineage for d1h99a2 (1h99 A:169-275)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.142: PTS-regulatory domain, PRD [63519] (1 superfamily)
   core: 4 helices; bundle, closed, right-handed twist; 1 crossover connection

4. Superfamily a.142.1: PTS-regulatory domain, PRD [63520] (1 family)
   duplication: consists of two domains of this fold
   automatically mapped to Pfam PF00874

5. Family a.142.1.1: PTS-regulatory domain, PRD [63521] (1 protein)

6. Protein Transcriptional antiterminator LicT [63522] (1 species)

7. Species Bacillus subtilis [TaxId:1423] [63523] (2 PDB entries)

8. Domain d1h99a2: 1h99 A:169-275 [60815]

Details for d1h99a2

PDB Entry: 1h99, 1.55 Å

PDB Description: prd of lict antiterminator from bacillus subtilis

PDB Compounds: (A:) transcription antiterminator lict

SCOPe Domain Sequences for d1h99a2:

Sequence, based on SEQRES records:

>d1h99a2 a.142.1.1 (A:169-275) Transcriptional antiterminator LicT {Bacillus subtilis [TaxId: 1423]}
mpniinitkvmeeilsivkyhfkiefneeslhyyrfvtdlkffaqrlfngthmeseddfl
ldtvkekyhrayectkkiqtyiereyehkltsdellyltidiervvk

Sequence, based on observed residues (ATOM records):

>d1h99a2 a.142.1.1 (A:169-275) Transcriptional antiterminator LicT {Bacillus subtilis [TaxId: 1423]}
mpniinitkvmeeilsivkyhfkiefneeslhyyrfvtdlkffaqrlfngthmeddflld
tvkekyhrayectkkiqtyiereyehkltsdellyltidiervvk

Timeline for d1h99a2:

• d1h99a2 first appeared in SCOP 1.57
  
• d1h99a2 appears in SCOPe 2.06
  
• d1h99a2 appears in the current release, SCOPe 2.08