SCOP 1.61: Domain d1h99a2: 1h99 A:169-275

Lineage for d1h99a2 (1h99 A:169-275)

1. Root: SCOP 1.61

2. Class a: All alpha proteins [46456] (151 folds)

3. Fold a.142: PTS-regulatory domain, PRD [63519] (1 superfamily)

4. Superfamily a.142.1: PTS-regulatory domain, PRD [63520] (1 family)

5. Family a.142.1.1: PTS-regulatory domain, PRD [63521] (1 protein)

6. Protein Transcriptional antiterminator LicT [63522] (1 species)

7. Species Bacillus subtilis [TaxId:1423] [63523] (1 PDB entry)

8. Domain d1h99a2: 1h99 A:169-275 [60815]

Details for d1h99a2

PDB Entry: 1h99, 1.55 Å

PDB Description: prd of lict antiterminator from bacillus subtilis

SCOP Domain Sequences for d1h99a2:

Sequence, based on SEQRES records:

>d1h99a2 a.142.1.1 (A:169-275) Transcriptional antiterminator LicT {Bacillus subtilis}
mpniinitkvmeeilsivkyhfkiefneeslhyyrfvtdlkffaqrlfngthmeseddfl
ldtvkekyhrayectkkiqtyiereyehkltsdellyltidiervvk

Sequence, based on observed residues (ATOM records):

>d1h99a2 a.142.1.1 (A:169-275) Transcriptional antiterminator LicT {Bacillus subtilis}
mpniinitkvmeeilsivkyhfkiefneeslhyyrfvtdlkffaqrlfngthmeddflld
tvkekyhrayectkkiqtyiereyehkltsdellyltidiervvk

Timeline for d1h99a2:

• d1h99a2 first appeared in SCOP 1.57
  
• d1h99a2 appears in SCOP 1.59
  
• d1h99a2 appears in SCOP 1.63
  
• d1h99a2 appears in the current release, SCOPe 2.08