Lineage for d1h99a2 (1h99 A:169-275)
- Root: SCOP 1.57
Class a: All alpha proteins [46456] (144 folds) 
Fold a.142: PTS-regulatory domain, PRD [63519] (1 superfamily) Superfamily a.142.1: PTS-regulatory domain, PRD [63520] (1 family) 
Family a.142.1.1: PTS-regulatory domain, PRD [63521] (1 protein) Protein Transcriptional antiterminator LicT [63522] (1 species) Species Bacillus subtilis [TaxId:1423] [63523] (1 PDB entry) 
Domain d1h99a2: 1h99 A:169-275 [60815]
Details for d1h99a2
PDB Entry: 1h99 (more details), 1.55 Å
PDB Description: prd of lict antiterminator from bacillus subtilis
SCOP Domain Sequences for d1h99a2:
Sequence, based on SEQRES records: (download)
>d1h99a2 a.142.1.1 (A:169-275) Transcriptional antiterminator LicT {Bacillus subtilis}
mpniinitkvmeeilsivkyhfkiefneeslhyyrfvtdlkffaqrlfngthmeseddfl
ldtvkekyhrayectkkiqtyiereyehkltsdellyltidiervvk
Sequence, based on observed residues (ATOM records): (download)
>d1h99a2 a.142.1.1 (A:169-275) Transcriptional antiterminator LicT {Bacillus subtilis}
mpniinitkvmeeilsivkyhfkiefneeslhyyrfvtdlkffaqrlfngthmeddflld
tvkekyhrayectkkiqtyiereyehkltsdellyltidiervvk
SCOP Domain Coordinates for d1h99a2:
Click to download the PDB-style file with coordinates for d1h99a2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1h99a2:
- d1h99a2 is new in SCOP 1.57
- d1h99a2 appears in SCOP 1.59
- d1h99a2 appears in the current release, SCOPe 2.08
View in 3D
