Class a: All alpha proteins [46456] (290 folds) |
Fold a.142: PTS-regulatory domain, PRD [63519] (1 superfamily) core: 4 helices; bundle, closed, right-handed twist; 1 crossover connection |
Superfamily a.142.1: PTS-regulatory domain, PRD [63520] (1 family) duplication: consists of two domains of this fold automatically mapped to Pfam PF00874 |
Family a.142.1.1: PTS-regulatory domain, PRD [63521] (1 protein) |
Protein Transcriptional antiterminator LicT [63522] (1 species) |
Species Bacillus subtilis [TaxId:1423] [63523] (2 PDB entries) |
Domain d1h99a2: 1h99 A:169-275 [60815] |
PDB Entry: 1h99 (more details), 1.55 Å
SCOPe Domain Sequences for d1h99a2:
Sequence, based on SEQRES records: (download)
>d1h99a2 a.142.1.1 (A:169-275) Transcriptional antiterminator LicT {Bacillus subtilis [TaxId: 1423]} mpniinitkvmeeilsivkyhfkiefneeslhyyrfvtdlkffaqrlfngthmeseddfl ldtvkekyhrayectkkiqtyiereyehkltsdellyltidiervvk
>d1h99a2 a.142.1.1 (A:169-275) Transcriptional antiterminator LicT {Bacillus subtilis [TaxId: 1423]} mpniinitkvmeeilsivkyhfkiefneeslhyyrfvtdlkffaqrlfngthmeddflld tvkekyhrayectkkiqtyiereyehkltsdellyltidiervvk
Timeline for d1h99a2: