Lineage for d1h99a2 (1h99 A:169-275)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2734741Fold a.142: PTS-regulatory domain, PRD [63519] (1 superfamily)
    core: 4 helices; bundle, closed, right-handed twist; 1 crossover connection
  4. 2734742Superfamily a.142.1: PTS-regulatory domain, PRD [63520] (1 family) (S)
    duplication: consists of two domains of this fold
    automatically mapped to Pfam PF00874
  5. 2734743Family a.142.1.1: PTS-regulatory domain, PRD [63521] (1 protein)
  6. 2734744Protein Transcriptional antiterminator LicT [63522] (1 species)
  7. 2734745Species Bacillus subtilis [TaxId:1423] [63523] (2 PDB entries)
  8. 2734747Domain d1h99a2: 1h99 A:169-275 [60815]

Details for d1h99a2

PDB Entry: 1h99 (more details), 1.55 Å

PDB Description: prd of lict antiterminator from bacillus subtilis
PDB Compounds: (A:) transcription antiterminator lict

SCOPe Domain Sequences for d1h99a2:

Sequence, based on SEQRES records: (download)

>d1h99a2 a.142.1.1 (A:169-275) Transcriptional antiterminator LicT {Bacillus subtilis [TaxId: 1423]}
mpniinitkvmeeilsivkyhfkiefneeslhyyrfvtdlkffaqrlfngthmeseddfl
ldtvkekyhrayectkkiqtyiereyehkltsdellyltidiervvk

Sequence, based on observed residues (ATOM records): (download)

>d1h99a2 a.142.1.1 (A:169-275) Transcriptional antiterminator LicT {Bacillus subtilis [TaxId: 1423]}
mpniinitkvmeeilsivkyhfkiefneeslhyyrfvtdlkffaqrlfngthmeddflld
tvkekyhrayectkkiqtyiereyehkltsdellyltidiervvk

SCOPe Domain Coordinates for d1h99a2:

Click to download the PDB-style file with coordinates for d1h99a2.
(The format of our PDB-style files is described here.)

Timeline for d1h99a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1h99a1