Lineage for d1h99a1 (1h99 A:54-168)
- Root: SCOP 1.59
Class a: All alpha proteins [46456] (151 folds) 
Fold a.142: PTS-regulatory domain, PRD [63519] (1 superfamily) Superfamily a.142.1: PTS-regulatory domain, PRD [63520] (1 family) 
Family a.142.1.1: PTS-regulatory domain, PRD [63521] (1 protein) Protein Transcriptional antiterminator LicT [63522] (1 species) Species Bacillus subtilis [TaxId:1423] [63523] (1 PDB entry) 
Domain d1h99a1: 1h99 A:54-168 [60814]
Details for d1h99a1
PDB Entry: 1h99 (more details), 1.55 Å
PDB Description: prd of lict antiterminator from bacillus subtilis
SCOP Domain Sequences for d1h99a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1h99a1 a.142.1.1 (A:54-168) Transcriptional antiterminator LicT {Bacillus subtilis}
gamekfktllydipiecmevseeiisyaklqlgkklndsiyvsltdhinfaiqrnqkgld
iknallwetkrlykdefaigkealvmvknktgvslpedeagfialhivnaelnee
SCOP Domain Coordinates for d1h99a1:
Click to download the PDB-style file with coordinates for d1h99a1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1h99a1:
- d1h99a1 first appeared in SCOP 1.57
- d1h99a1 appears in SCOP 1.61
- d1h99a1 appears in the current release, SCOPe 2.08
View in 3D
