Structural Classification of Proteins and ASTRAL release 1.75 (June 2009)
Search SCOP (example):

Lineage for d1h96a_ (1h96 A:)

  1. Root: SCOP 1.75
  2. Class a: All alpha proteins [46456] (284 folds)
  3. Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. Superfamily a.25.1: Ferritin-like [47240] (9 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. Family a.25.1.1: Ferritin [47241] (9 protein domains)
  6. Protein (Apo)ferritin [47246] (7 species)
  7. Species Mouse (Mus musculus) [TaxId:10090] [63526] (2 PDB entries)
  8. Domain d1h96a_: 1h96 A: [60811]
    complexed with cd, so4; mutant

Details for d1h96a_

PDB Entry: 1h96 (more details)
PDB Description: recombinant mouse l-chain ferritin
PDB Compounds: (A:) ferritin light chain 1

SCOP Domain Sequences for d1h96a_:

Sequence, based on SEQRES records: (download)

>d1h96a_ a.25.1.1 (A:) (Apo)ferritin {Mouse (Mus musculus) [TaxId: 10090]}
tsqirqnysteveaavnrlvnlhlrasytylslgfffdrddvalegvghffrelaeekre
gaerllefqndrggralfqdvqkpsqdewgktqeameaalameknlnqalldlhalgsar
adphlcdfleshyldkevklikkmgnhltnlrrvagpqpaqtgapqgslgeylferltlk

Sequence, based on observed residues (ATOM records): (download)
>d1h96a_ a.25.1.1 (A:) (Apo)ferritin {Mouse (Mus musculus) [TaxId: 10090]}
tsqirqnysteveaavnrlvnlhlrasytylslgfffdrddvalegvghffrelaeekre
gaerllefqndrggralfqdvqkpsqdewgktqeameaalameknlnqalldlhalgsar
adphlcdfleshyldkevklikkmgnhltnlrrvagslgeylferltlk

SCOP Domain Coordinates for d1h96a_:

Click to download the PDB-style file with coordinates for d1h96a_.
(The format of our PDB-style files is described here.)

Timeline for d1h96a_:

d1h96a_ appears in SCOP 1.73
d1h96a_ appears in SCOP 1.75A


d1h96a_
(click for larger image)


d1h96a_ in context of chain

SCOP Copyright © 1994-2013 The SCOP and Astral authors
scop@mrc-lmb.cam.ac.uk and astral@compbio.berkeley.edu