Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (22 proteins) family members also share a common alpha+beta fold in C-terminal domain |
Protein Glucose 6-phosphate dehydrogenase, N-terminal domain [51827] (2 species) |
Species Leuconostoc mesenteroides [TaxId:1245] [51828] (9 PDB entries) |
Domain d1h94a1: 1h94 A:1-181,A:413-426 [60809] Other proteins in same PDB: d1h94a2 complexed with nad; mutant |
PDB Entry: 1h94 (more details), 2.5 Å
SCOPe Domain Sequences for d1h94a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1h94a1 c.2.1.3 (A:1-181,A:413-426) Glucose 6-phosphate dehydrogenase, N-terminal domain {Leuconostoc mesenteroides [TaxId: 1245]} vseiktlvtffggtgdlakrklypsvfnlykkgylqkhfaivgtarqalnddefkqlvrd sikdftddqaqaeafiehfsyrahdvtdaasyavlkeaieeaadkfdidgnrifymsvap rffgtiakylkseglladtgynrlmiekpfgtsydtaaelqndlenafddnqlfridhyl gXepyermihdtmngd
Timeline for d1h94a1: