Lineage for d1h94a1 (1h94 A:1-181,A:413-426)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2843543Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (22 proteins)
    family members also share a common alpha+beta fold in C-terminal domain
  6. 2843727Protein Glucose 6-phosphate dehydrogenase, N-terminal domain [51827] (2 species)
  7. 2843737Species Leuconostoc mesenteroides [TaxId:1245] [51828] (9 PDB entries)
  8. 2843746Domain d1h94a1: 1h94 A:1-181,A:413-426 [60809]
    Other proteins in same PDB: d1h94a2
    complexed with nad; mutant

Details for d1h94a1

PDB Entry: 1h94 (more details), 2.5 Å

PDB Description: complex of active mutant (s215->c) of glucose 6-phosphate dehydrogenase from l.mesenteroides with coenzyme nad
PDB Compounds: (A:) glucose 6-phosphate 1-dehydrogenase

SCOPe Domain Sequences for d1h94a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h94a1 c.2.1.3 (A:1-181,A:413-426) Glucose 6-phosphate dehydrogenase, N-terminal domain {Leuconostoc mesenteroides [TaxId: 1245]}
vseiktlvtffggtgdlakrklypsvfnlykkgylqkhfaivgtarqalnddefkqlvrd
sikdftddqaqaeafiehfsyrahdvtdaasyavlkeaieeaadkfdidgnrifymsvap
rffgtiakylkseglladtgynrlmiekpfgtsydtaaelqndlenafddnqlfridhyl
gXepyermihdtmngd

SCOPe Domain Coordinates for d1h94a1:

Click to download the PDB-style file with coordinates for d1h94a1.
(The format of our PDB-style files is described here.)

Timeline for d1h94a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1h94a2