SCOP 1.57: Domain d1h8ve_: 1h8v E:

Lineage for d1h8ve_ (1h8v E:)

1. Root: SCOP 1.57

2. Class b: All beta proteins [48724] (104 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (11 families)

5. Family b.29.1.11: Xylanase/endoglucanase 12 [49978] (2 proteins)

6. Protein Endo-1,4-beta-glucanase (cellulase) catalytic domain [49991] (2 species)

7. Species Trichoderma reesei, Cel12A [TaxId:51453] [63731] (1 PDB entry)

8. Domain d1h8ve_: 1h8v E: [60799]

Details for d1h8ve_

PDB Entry: 1h8v, 1.9 Å

PDB Description: the x-ray crystal structure of the trichoderma reesei family 12 endoglucanase 3, cel12a, at 1.9 a resolution

SCOP Domain Sequences for d1h8ve_:

Sequence; same for both SEQRES and ATOM records:

>d1h8ve_ b.29.1.11 (E:) Endo-1,4-beta-glucanase (cellulase) catalytic domain {Trichoderma reesei, Cel12A}
etscdqwatftgngytvsnnlwgasagsgfgcvtavslsggaswhadwqwsggqnnvksy
qnsqiaipqkrtvnsissmpttaswsysgsniranvaydlftaanpnhvtysgdyelmiw
lgkygdigpigssqgtvnvggqswtlyygyngamqvysfvaqtnttnysgdvknffnylr
dnkgynaagqyvlsyqfgtepftgsgtlnvaswtasin

Timeline for d1h8ve_:

• d1h8ve_ is new in SCOP 1.57
  
• d1h8ve_ appears in SCOP 1.59
  
• d1h8ve_ appears in the current release, SCOPe 2.08