SCOPe 2.05: Domain d1h8vd_: 1h8v D:

Lineage for d1h8vd_ (1h8v D:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families)

5. Family b.29.1.11: Xylanase/endoglucanase 11/12 [49978] (3 proteins)

6. Protein Family 12 endo-1,4-beta-glucanase (cellulase) catalytic domain [49991] (7 species)

7. Species Trichoderma reesei, Cel12A [TaxId:51453] [63731] (3 PDB entries)

8. Domain d1h8vd_: 1h8v D: [60798]
   complexed with nag

Details for d1h8vd_

PDB Entry: 1h8v, 1.9 Å

PDB Description: the x-ray crystal structure of the trichoderma reesei family 12 endoglucanase 3, cel12a, at 1.9 a resolution

PDB Compounds: (D:) endo-beta-1,4-glucanase

SCOPe Domain Sequences for d1h8vd_:

Sequence; same for both SEQRES and ATOM records:

>d1h8vd_ b.29.1.11 (D:) Family 12 endo-1,4-beta-glucanase (cellulase) catalytic domain {Trichoderma reesei, Cel12A [TaxId: 51453]}
etscdqwatftgngytvsnnlwgasagsgfgcvtavslsggaswhadwqwsggqnnvksy
qnsqiaipqkrtvnsissmpttaswsysgsniranvaydlftaanpnhvtysgdyelmiw
lgkygdigpigssqgtvnvggqswtlyygyngamqvysfvaqtnttnysgdvknffnylr
dnkgynaagqyvlsyqfgtepftgsgtlnvaswtasin

Timeline for d1h8vd_:

• d1h8vd_ first appeared in SCOP 1.57
  
• d1h8vd_ appears in SCOPe 2.04
  
• d1h8vd_ appears in SCOPe 2.06
  
• d1h8vd_ appears in the current release, SCOPe 2.08