Lineage for d1h8vb_ (1h8v B:)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 57551Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
  4. 57552Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (11 families) (S)
  5. 58044Family b.29.1.11: Xylanase/endoglucanase 12 [49978] (2 proteins)
  6. 58045Protein Endo-1,4-beta-glucanase (cellulase) catalytic domain [49991] (2 species)
  7. 58049Species Trichoderma reesei, Cel12A [TaxId:51453] [63731] (1 PDB entry)
  8. 58051Domain d1h8vb_: 1h8v B: [60796]

Details for d1h8vb_

PDB Entry: 1h8v (more details), 1.9 Å

PDB Description: the x-ray crystal structure of the trichoderma reesei family 12 endoglucanase 3, cel12a, at 1.9 a resolution

SCOP Domain Sequences for d1h8vb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h8vb_ b.29.1.11 (B:) Endo-1,4-beta-glucanase (cellulase) catalytic domain {Trichoderma reesei, Cel12A}
etscdqwatftgngytvsnnlwgasagsgfgcvtavslsggaswhadwqwsggqnnvksy
qnsqiaipqkrtvnsissmpttaswsysgsniranvaydlftaanpnhvtysgdyelmiw
lgkygdigpigssqgtvnvggqswtlyygyngamqvysfvaqtnttnysgdvknffnylr
dnkgynaagqyvlsyqfgtepftgsgtlnvaswtasin

SCOP Domain Coordinates for d1h8vb_:

Click to download the PDB-style file with coordinates for d1h8vb_.
(The format of our PDB-style files is described here.)

Timeline for d1h8vb_: