Lineage for d1h8va_ (1h8v A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2778274Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2778275Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) (S)
  5. 2780055Family b.29.1.11: Xylanase/endoglucanase 11/12 [49978] (3 proteins)
  6. 2780056Protein Family 12 endo-1,4-beta-glucanase (cellulase) catalytic domain [49991] (7 species)
  7. 2780085Species Trichoderma reesei, Cel12A [TaxId:51453] [63731] (3 PDB entries)
  8. 2780094Domain d1h8va_: 1h8v A: [60795]
    complexed with nag

Details for d1h8va_

PDB Entry: 1h8v (more details), 1.9 Å

PDB Description: the x-ray crystal structure of the trichoderma reesei family 12 endoglucanase 3, cel12a, at 1.9 a resolution
PDB Compounds: (A:) endo-beta-1,4-glucanase

SCOPe Domain Sequences for d1h8va_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h8va_ b.29.1.11 (A:) Family 12 endo-1,4-beta-glucanase (cellulase) catalytic domain {Trichoderma reesei, Cel12A [TaxId: 51453]}
etscdqwatftgngytvsnnlwgasagsgfgcvtavslsggaswhadwqwsggqnnvksy
qnsqiaipqkrtvnsissmpttaswsysgsniranvaydlftaanpnhvtysgdyelmiw
lgkygdigpigssqgtvnvggqswtlyygyngamqvysfvaqtnttnysgdvknffnylr
dnkgynaagqyvlsyqfgtepftgsgtlnvaswtasin

SCOPe Domain Coordinates for d1h8va_:

Click to download the PDB-style file with coordinates for d1h8va_.
(The format of our PDB-style files is described here.)

Timeline for d1h8va_: