SCOPe 2.07: Domain d1h8ob2: 1h8o B:133-243

Lineage for d1h8ob2 (1h8o B:133-243)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein Immunoglobulin heavy chain variable domain, VH [88543] (22 species)
   VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 3.2 [TaxId:10090] [88552] (184 PDB entries)
   Uniprot P01756 1-117 # 78% sequense identity; HV12_MOUSE Ig heavy chain V region MOPC 104E ! SQ NA # humanized antibody ! Uniprot P01750 # HV06_MOUSE Ig heavy chain V region 102 precursor ! Uniprot P01750 20-116 # ! HV06_MOUSE Ig heavy chain V region 102 precursor

8. Domain d1h8ob2: 1h8o B:133-243 [60788]
   Other proteins in same PDB: d1h8oa1, d1h8ob1
   part of anti-ampicillin scFv
   complexed with so4; mutant

Details for d1h8ob2

PDB Entry: 1h8o, 2.75 Å

PDB Description: three-dimensional structure of anti-ampicillin single chain fv fragment.

PDB Compounds: (B:) mutant al2 6e7p9g

SCOPe Domain Sequences for d1h8ob2:

Sequence; same for both SEQRES and ATOM records:

>d1h8ob2 b.1.1.1 (B:133-243) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]}
vqlqepggelvrpgasvklsckasgytftsywinwvkqrpgqglewigniypsdsytnyn
qkfkdkatltvdkssstaymqlssltsedsavyfcarwgywgqgtlvtvsa

Timeline for d1h8ob2:

• d1h8ob2 first appeared in SCOP 1.57
  
• d1h8ob2 appears in SCOPe 2.06
  
• d1h8ob2 appears in the current release, SCOPe 2.08