Lineage for d1h8na2 (1h8n A:132-243)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 51640Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 51641Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 51642Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 protein domains)
  6. 51698Protein Immunoglobulin (variable domains of L and H chains) [48749] (195 species)
  7. 51708Species Anti-ampicillin scFv, (mouse), kappa L chain [63645] (3 PDB entries)
  8. 51710Domain d1h8na2: 1h8n A:132-243 [60784]

Details for d1h8na2

PDB Entry: 1h8n (more details), 1.87 Å

PDB Description: three-dimensional structure of anti-ampicillin single chain fv fragment from phage-displayed murine antibody libraries

SCOP Domain Sequences for d1h8na2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h8na2 b.1.1.1 (A:132-243) Immunoglobulin (variable domains of L and H chains) {Anti-ampicillin scFv, (mouse), kappa L chain}
qvqlqesggelvrpgasvklsckasgytftsywinwvkqrpgqglewigniypsdsytny
nqkfkdkatltvdkssstaymqlssltsedsavyfcarwgywgqgtlvtvsa

SCOP Domain Coordinates for d1h8na2:

Click to download the PDB-style file with coordinates for d1h8na2.
(The format of our PDB-style files is described here.)

Timeline for d1h8na2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1h8na1