Lineage for d1h8jc_ (1h8j C:)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 414977Fold d.85: RNA bacteriophage capsid protein [55404] (1 superfamily)
    6-standed beta-sheet followed with 2 helices; meander
  4. 414978Superfamily d.85.1: RNA bacteriophage capsid protein [55405] (1 family) (S)
  5. 414979Family d.85.1.1: RNA bacteriophage capsid protein [55406] (5 proteins)
  6. 415028Protein MS2 virus coat protein [55407] (1 species)
  7. 415029Species Bacteriophage MS2 [TaxId:12022] [55408] (25 PDB entries)
  8. 415042Domain d1h8jc_: 1h8j C: [60781]

Details for d1h8jc_

PDB Entry: 1h8j (more details), 2.8 Å

PDB Description: ms2-rna hairpin (g-5) complex

SCOP Domain Sequences for d1h8jc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h8jc_ d.85.1.1 (C:) MS2 virus coat protein {Bacteriophage MS2}
asnftqfvlvdnggtgdvtvapsnfangvaewissnsrsqaykvtcsvrqssaqnrkyti
kvevpkvatqtvggvelpvaawrsylnmeltipifatnsdcelivkamqgllkdgnpips
aiaansgiy

SCOP Domain Coordinates for d1h8jc_:

Click to download the PDB-style file with coordinates for d1h8jc_.
(The format of our PDB-style files is described here.)

Timeline for d1h8jc_: