Lineage for d1h8jb_ (1h8j B:)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 507379Fold d.85: RNA bacteriophage capsid protein [55404] (1 superfamily)
    6-standed beta-sheet followed with 2 helices; meander
  4. 507380Superfamily d.85.1: RNA bacteriophage capsid protein [55405] (1 family) (S)
  5. 507381Family d.85.1.1: RNA bacteriophage capsid protein [55406] (5 proteins)
  6. 507430Protein MS2 virus coat protein [55407] (1 species)
  7. 507431Species Bacteriophage MS2 [TaxId:12022] [55408] (25 PDB entries)
  8. 507443Domain d1h8jb_: 1h8j B: [60780]

Details for d1h8jb_

PDB Entry: 1h8j (more details), 2.8 Å

PDB Description: ms2-rna hairpin (g-5) complex

SCOP Domain Sequences for d1h8jb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h8jb_ d.85.1.1 (B:) MS2 virus coat protein {Bacteriophage MS2}
asnftqfvlvdnggtgdvtvapsnfangvaewissnsrsqaykvtcsvrqssaqnrkyti
kvevpkvatqtvggvelpvaawrsylnmeltipifatnsdcelivkamqgllkdgnpips
aiaansgiy

SCOP Domain Coordinates for d1h8jb_:

Click to download the PDB-style file with coordinates for d1h8jb_.
(The format of our PDB-style files is described here.)

Timeline for d1h8jb_: