Class b: All beta proteins [48724] (144 folds) |
Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) |
Family b.47.1.2: Eukaryotic proteases [50514] (46 proteins) |
Protein Thrombin [50531] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [50532] (155 PDB entries) |
Domain d1h8i.1: 1h8i L:,H: [60778] |
PDB Entry: 1h8i (more details), 1.75 Å
SCOP Domain Sequences for d1h8i.1:
Sequence; same for both SEQRES and ATOM records: (download)
>g1h8i.1 b.47.1.2 (L:,H:) Thrombin {Human (Homo sapiens)} adcglrplfekksledkterellesyiXivegsdaeigmspwqvmlfrkspqellcgasl isdrwvltaahcllyppwdknftendllvrigkhsrtryerniekismlekiyihprynw renldrdialmklkkpvafsdyihpvclpdretaasllqagykgrvtgwgnlketwgqps vlqvvnlpiverpvckdstriritdnmfcagykpdegkrgdacegdsggpfvmkspfnnr wyqmgivswgegcdrdgkygfythvfrlkkwiqkvidqfge
Timeline for d1h8i.1: