Lineage for d1h8hg_ (1h8h G:)

  1. Root: SCOP 1.65
  2. 305035Class c: Alpha and beta proteins (a/b) [51349] (121 folds)
  3. 316067Fold c.49: Pyruvate kinase C-terminal domain-like [52934] (2 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145, strand 5 is antiparallel to the rest
  4. 316159Superfamily c.49.2: ATP synthase (F1-ATPase), gamma subunit [52943] (1 family) (S)
    contains an antiparallel coiled coil formed by N- and C-terminal extensions to the common fold
  5. 316160Family c.49.2.1: ATP synthase (F1-ATPase), gamma subunit [52944] (1 protein)
  6. 316161Protein ATP synthase (F1-ATPase), gamma subunit [52945] (3 species)
  7. 316162Species Cow (Bos taurus) [TaxId:9913] [52946] (10 PDB entries)
  8. 316170Domain d1h8hg_: 1h8h G: [60777]
    Other proteins in same PDB: d1h8ha1, d1h8ha2, d1h8ha3, d1h8hb1, d1h8hb2, d1h8hb3, d1h8hc1, d1h8hc2, d1h8hc3, d1h8hd1, d1h8hd2, d1h8hd3, d1h8he1, d1h8he2, d1h8he3, d1h8hf1, d1h8hf2, d1h8hf3
    core domain is disordered; only coiled coil part is visible
    complexed with adp, atp, gol, mg, po4

Details for d1h8hg_

PDB Entry: 1h8h (more details), 2.9 Å

PDB Description: bovine mitochondrial f1-atpase crystallised in the presence of 5mm amppnp

SCOP Domain Sequences for d1h8hg_:

Sequence, based on SEQRES records: (download)

>d1h8hg_ c.49.2.1 (G:) ATP synthase (F1-ATPase), gamma subunit {Cow (Bos taurus)}
atlkditrrlksikniqkitksmkmvaaakyaraerelkparvygvgslalyekadiktp
edkkkhliigvssdrglcgaihssvakqmkseaanlaaagkevkiigvgdkirsilhrth
sdqflvtfkevgrrpptfgdasvialellnsgyefdegsiifnrfrsvisykteekpifs
ldtissaesmsiyddidadvlrnyqeyslaniiyyslkesttseqsarmtamdnasknas
emidkltltfnrtrqavitkelieiisgaaal

Sequence, based on observed residues (ATOM records): (download)

>d1h8hg_ c.49.2.1 (G:) ATP synthase (F1-ATPase), gamma subunit {Cow (Bos taurus)}
atlkditrrlksikniqkitksmkmvaaakyaraerelkparvylcgaihssvakqmkla
niiyyslkesttseqsarmtamdnasknasemidkltltfnrtrqavitkelieiisgaa
al

SCOP Domain Coordinates for d1h8hg_:

Click to download the PDB-style file with coordinates for d1h8hg_.
(The format of our PDB-style files is described here.)

Timeline for d1h8hg_: