Lineage for d1h8hf1 (1h8h F:358-474)

  1. Root: SCOP 1.63
  2. 208553Class a: All alpha proteins [46456] (171 folds)
  3. 215201Fold a.69: Left-handed superhelix [47916] (3 superfamilies)
    core: 4-5 helices; bundle; left-handed superhelix
  4. 215202Superfamily a.69.1: C-terminal domain of alpha and beta subunits of F1 ATP synthase [47917] (1 family) (S)
  5. 215203Family a.69.1.1: C-terminal domain of alpha and beta subunits of F1 ATP synthase [47918] (1 protein)
  6. 215204Protein C-terminal domain of alpha and beta subunits of F1 ATP synthase [47919] (4 species)
  7. 215208Species Cow (Bos taurus) [TaxId:9913] [47920] (9 PDB entries)
  8. 215256Domain d1h8hf1: 1h8h F:358-474 [60774]
    Other proteins in same PDB: d1h8ha2, d1h8ha3, d1h8hb2, d1h8hb3, d1h8hc2, d1h8hc3, d1h8hd2, d1h8hd3, d1h8he2, d1h8he3, d1h8hf2, d1h8hf3, d1h8hg_
    complexed with adp, atp, gol, mg, po4

Details for d1h8hf1

PDB Entry: 1h8h (more details), 2.9 Å

PDB Description: bovine mitochondrial f1-atpase crystallised in the presence of 5mm amppnp

SCOP Domain Sequences for d1h8hf1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h8hf1 a.69.1.1 (F:358-474) C-terminal domain of alpha and beta subunits of F1 ATP synthase {Cow (Bos taurus)}
mdpnivgsehydvargvqkilqdykslqdiiailgmdelseedkltvsrarkiqrflsqp
fqvaevftghlgklvplketikgfqqilageydhlpeqafymvgpieeavakadkla

SCOP Domain Coordinates for d1h8hf1:

Click to download the PDB-style file with coordinates for d1h8hf1.
(The format of our PDB-style files is described here.)

Timeline for d1h8hf1: