SCOPe 2.02: Domain d1h8hd1: 1h8h D:358-475

Lineage for d1h8hd1 (1h8h D:358-475)

1. Root: SCOPe 2.02

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.69: Left-handed superhelix [47916] (4 superfamilies)
   core: 4-5 helices; bundle; left-handed superhelix

4. Superfamily a.69.1: C-terminal domain of alpha and beta subunits of F1 ATP synthase [47917] (1 family)

5. Family a.69.1.1: C-terminal domain of alpha and beta subunits of F1 ATP synthase [47918] (2 proteins)

6. Protein F1 ATP synthase beta subunit, domain 3 [88928] (4 species)

7. Species Cow (Bos taurus) [TaxId:9913] [88929] (14 PDB entries)
   Uniprot P00829

8. Domain d1h8hd1: 1h8h D:358-475 [60768]
   Other proteins in same PDB: d1h8ha1, d1h8ha2, d1h8ha3, d1h8hb1, d1h8hb2, d1h8hb3, d1h8hc1, d1h8hc2, d1h8hc3, d1h8hd2, d1h8hd3, d1h8he2, d1h8he3, d1h8hf2, d1h8hf3, d1h8hg_
   complexed with adp, atp, gol, mg, po4

Details for d1h8hd1

PDB Entry: 1h8h, 2.9 Å

PDB Description: bovine mitochondrial f1-atpase crystallised in the presence of 5mm amppnp

PDB Compounds: (D:) bovine mitochondrial f1-ATPase

SCOPe Domain Sequences for d1h8hd1:

Sequence; same for both SEQRES and ATOM records:

>d1h8hd1 a.69.1.1 (D:358-475) F1 ATP synthase beta subunit, domain 3 {Cow (Bos taurus) [TaxId: 9913]}
mdpnivgsehydvargvqkilqdykslqdiiailgmdelseedkltvsrarkiqrflsqp
fqvaevftghlgklvplketikgfqqilageydhlpeqafymvgpieeavakadklae

Timeline for d1h8hd1:

• d1h8hd1 first appeared in SCOP 1.57
  
• d1h8hd1 appears in SCOPe 2.01
  
• d1h8hd1 appears in SCOPe 2.03
  
• d1h8hd1 appears in the current release, SCOPe 2.08