Lineage for d1h8hb3 (1h8h B:95-379)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 829350Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 829351Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (24 families) (S)
    division into families based on beta-sheet topologies
  5. 831197Family c.37.1.11: RecA protein-like (ATPase-domain) [52670] (17 proteins)
    core: mixed beta-sheet of 8 strands, order 32451678; strand 7 is antiparallel to the rest
  6. 831253Protein Central domain of alpha subunit of F1 ATP synthase [88774] (4 species)
  7. 831256Species Cow (Bos taurus) [TaxId:9913] [88775] (14 PDB entries)
    Uniprot P19483
  8. 831294Domain d1h8hb3: 1h8h B:95-379 [60764]
    Other proteins in same PDB: d1h8ha1, d1h8ha2, d1h8hb1, d1h8hb2, d1h8hc1, d1h8hc2, d1h8hd1, d1h8hd2, d1h8hd3, d1h8he1, d1h8he2, d1h8he3, d1h8hf1, d1h8hf2, d1h8hf3, d1h8hg_

Details for d1h8hb3

PDB Entry: 1h8h (more details), 2.9 Å

PDB Description: bovine mitochondrial f1-atpase crystallised in the presence of 5mm amppnp
PDB Compounds: (B:) bovine mitochondrial f1-ATPase

SCOP Domain Sequences for d1h8hb3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h8hb3 c.37.1.11 (B:95-379) Central domain of alpha subunit of F1 ATP synthase {Cow (Bos taurus) [TaxId: 9913]}
vdvpvgeellgrvvdalgnaidgkgpigskarrrvglkapgiiprisvrepmqtgikavd
slvpigrgqreliigdrqtgktsiaidtiinqkrfndgtdekkklyciyvaigqkrstva
qlvkrltdadamkytivvsatasdaaplqylapysgcsmgeyfrdngkhaliiyddlskq
avayrqmslllrrppgreaypgdvfylhsrlleraakmndafgggsltalpvietqagdv
sayiptnvisitdgqifletelfykgirpainvglsvsrvgsaaq

SCOP Domain Coordinates for d1h8hb3:

Click to download the PDB-style file with coordinates for d1h8hb3.
(The format of our PDB-style files is described here.)

Timeline for d1h8hb3: