| Class a: All alpha proteins [46456] (179 folds) |
| Fold a.69: Left-handed superhelix [47916] (3 superfamilies) core: 4-5 helices; bundle; left-handed superhelix |
Superfamily a.69.1: C-terminal domain of alpha and beta subunits of F1 ATP synthase [47917] (1 family) ![]() |
| Family a.69.1.1: C-terminal domain of alpha and beta subunits of F1 ATP synthase [47918] (2 proteins) |
| Protein F1 ATP synthase alpha subunit, domain 3 [88886] (4 species) |
| Species Cow (Bos taurus) [TaxId:9913] [88893] (10 PDB entries) |
| Domain d1h8hb1: 1h8h B:380-510 [60762] Other proteins in same PDB: d1h8ha2, d1h8ha3, d1h8hb2, d1h8hb3, d1h8hc2, d1h8hc3, d1h8hd1, d1h8hd2, d1h8hd3, d1h8he1, d1h8he2, d1h8he3, d1h8hf1, d1h8hf2, d1h8hf3, d1h8hg_ |
PDB Entry: 1h8h (more details), 2.9 Å
SCOP Domain Sequences for d1h8hb1:
Sequence, based on SEQRES records: (download)
>d1h8hb1 a.69.1.1 (B:380-510) F1 ATP synthase alpha subunit, domain 3 {Cow (Bos taurus)}
tramkqvagtmklelaqyrevaafaqfgsdldaatqqllsrgvrltellkqgqyspmaie
eqvaviyagvrgyldklepskitkfenaflshvisqhqallgkirtdgkiseesdaklke
ivtnflagfea
>d1h8hb1 a.69.1.1 (B:380-510) F1 ATP synthase alpha subunit, domain 3 {Cow (Bos taurus)}
tramkqvagtmklelaqyrevaldaatqqllsrgvrltellkqgqyspmaieeqvaviya
gvrgyldklepskitkfenaflshvisqhqallgkirtdgkiseesdaklkeivtnflag
fea
Timeline for d1h8hb1: