| Class a: All alpha proteins [46456] (179 folds) |
| Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (9 superfamilies) not a true fold |
Superfamily a.137.8: Epsilon subunit of mitochondrial F1F0-ATP synthase [48690] (1 family) ![]() |
| Family a.137.8.1: Epsilon subunit of mitochondrial F1F0-ATP synthase [48691] (1 protein) |
| Protein Epsilon subunit of mitochondrial F1F0-ATP synthase [48692] (1 species) |
| Species Cow (Bos taurus) [TaxId:9913] [48693] (2 PDB entries) |
| Domain d1h8ei_: 1h8e I: [60758] Other proteins in same PDB: d1h8ea1, d1h8ea2, d1h8ea3, d1h8eb1, d1h8eb2, d1h8eb3, d1h8ec1, d1h8ec2, d1h8ec3, d1h8ed1, d1h8ed2, d1h8ed3, d1h8ee1, d1h8ee2, d1h8ee3, d1h8ef1, d1h8ef2, d1h8ef3, d1h8eg_, d1h8eh_ disordered complexed with adp, alf, gol, mg, so4 |
PDB Entry: 1h8e (more details), 2 Å
SCOP Domain Sequences for d1h8ei_:
Sequence, based on SEQRES records: (download)
>d1h8ei_ a.137.8.1 (I:) Epsilon subunit of mitochondrial F1F0-ATP synthase {Cow (Bos taurus)}
vaywrqaglsyirysqicakavrdalktefkanamktsgstikivkv
>d1h8ei_ a.137.8.1 (I:) Epsilon subunit of mitochondrial F1F0-ATP synthase {Cow (Bos taurus)}
vaywrqaglsyirysqicakavrdatsgstikivkv
Timeline for d1h8ei_: