Lineage for d1h8eg_ (1h8e G:)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 71332Fold c.49: Pyruvate kinase C-terminal domain-like [52934] (2 superfamilies)
  4. 71391Superfamily c.49.2: ATP syntase (F1-ATPase), gamma subunit [52943] (1 family) (S)
  5. 71392Family c.49.2.1: ATP syntase (F1-ATPase), gamma subunit [52944] (1 protein)
  6. 71393Protein ATP syntase (F1-ATPase), gamma subunit [52945] (3 species)
  7. 71394Species Cow (Bos taurus) [TaxId:9913] [52946] (9 PDB entries)
  8. 71396Domain d1h8eg_: 1h8e G: [60756]
    Other proteins in same PDB: d1h8ea1, d1h8ea2, d1h8ea3, d1h8eb1, d1h8eb2, d1h8eb3, d1h8ec1, d1h8ec2, d1h8ec3, d1h8ed1, d1h8ed2, d1h8ed3, d1h8ee1, d1h8ee2, d1h8ee3, d1h8ef1, d1h8ef2, d1h8ef3, d1h8eh_, d1h8ei_

Details for d1h8eg_

PDB Entry: 1h8e (more details), 2 Å

PDB Description: (adp.alf4)2(adp.so4) bovine f1-atpase (all three catalytic sites occupied)

SCOP Domain Sequences for d1h8eg_:

Sequence, based on SEQRES records: (download)

>d1h8eg_ c.49.2.1 (G:) ATP syntase (F1-ATPase), gamma subunit {Cow (Bos taurus)}
atlkditrrlksikniqkitksmkmvaaakyaraerelkparvygvgslalyekadiktp
edkkkhliigvssdrglcgaihssvakqmkseaanlaaagkevkiigvgdkirsilhrth
sdqflvtfkevgrrpptfgdasvialellnsgyefdegsiifnrfrsvisykteekpifs
ldtissaesmsiyddidadvlrnyqeyslaniiyyslkesttseqsarmtamdnasknas
emidkltltfnrtrqavitkelieiisgaaal

Sequence, based on observed residues (ATOM records): (download)

>d1h8eg_ c.49.2.1 (G:) ATP syntase (F1-ATPase), gamma subunit {Cow (Bos taurus)}
atlkditrrlksikniqkitksmkmvaaakyaraerelkparvygvgslalyekadilii
gvssdrglcgaihssvakqmkseaanlkevkiigvgdkirsilhtfkevgrrpptfgdas
vialellnegsiifnrfrsvisykteekpifsldtissaesmsiyddidadvlrnyqeys
laniiyyslkesttseqsarmtamdnasknasemidkltltfnrtrqavitkelieiisg
aaal

SCOP Domain Coordinates for d1h8eg_:

Click to download the PDB-style file with coordinates for d1h8eg_.
(The format of our PDB-style files is described here.)

Timeline for d1h8eg_: