| Class b: All beta proteins [48724] (141 folds) |
| Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (3 superfamilies) barrel, closed; n=6, S=8; greek-key |
Superfamily b.49.1: N-terminal domain of alpha and beta subunits of F1 ATP synthase [50615] (1 family) ![]() |
| Family b.49.1.1: N-terminal domain of alpha and beta subunits of F1 ATP synthase [50616] (2 proteins) 6 domains form a ring structure which contains a barrel, closed; n=24, S=24(?) |
| Protein F1 ATP synthase beta subunit, domain 1 [88677] (4 species) |
| Species Cow (Bos taurus) [TaxId:9913] [88678] (10 PDB entries) |
| Domain d1h8ef2: 1h8e F:9-81 [60754] Other proteins in same PDB: d1h8ea1, d1h8ea2, d1h8ea3, d1h8eb1, d1h8eb2, d1h8eb3, d1h8ec1, d1h8ec2, d1h8ec3, d1h8ed1, d1h8ed3, d1h8ee1, d1h8ee3, d1h8ef1, d1h8ef3, d1h8eg_, d1h8eh_, d1h8ei_ complexed with adp, alf, gol, mg, so4 |
PDB Entry: 1h8e (more details), 2 Å
SCOP Domain Sequences for d1h8ef2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1h8ef2 b.49.1.1 (F:9-81) F1 ATP synthase beta subunit, domain 1 {Cow (Bos taurus)}
ttgrivavigavvdvqfdeglppilnalevqgretrlvlevaqhlgestvrtiamdgteg
lvrgqkvldsgap
Timeline for d1h8ef2: