| Class c: Alpha and beta proteins (a/b) [51349] (130 folds) |
| Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (22 families) ![]() division into families based on beta-sheet topologies |
| Family c.37.1.11: RecA protein-like (ATPase-domain) [52670] (12 proteins) core: mixed beta-sheet of 8 strands, order 32451678; strand 7 is antiparallel to the rest |
| Protein Central domain of beta subunit of F1 ATP synthase [88779] (4 species) |
| Species Cow (Bos taurus) [TaxId:9913] [88780] (10 PDB entries) |
| Domain d1h8ed3: 1h8e D:82-357 [60749] Other proteins in same PDB: d1h8ea1, d1h8ea2, d1h8ea3, d1h8eb1, d1h8eb2, d1h8eb3, d1h8ec1, d1h8ec2, d1h8ec3, d1h8ed1, d1h8ed2, d1h8ee1, d1h8ee2, d1h8ef1, d1h8ef2, d1h8eg_, d1h8eh_, d1h8ei_ |
PDB Entry: 1h8e (more details), 2 Å
SCOP Domain Sequences for d1h8ed3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1h8ed3 c.37.1.11 (D:82-357) Central domain of beta subunit of F1 ATP synthase {Cow (Bos taurus)}
iripvgpetlgrimnvigepidergpiktkqfaaihaeapefvemsveqeilvtgikvvd
llapyakggkiglfggagvgktvlimelinnvakahggysvfagvgertregndlyhemi
esgvinlkdatskvalvygqmneppgararvaltgltvaeyfrdqegqdvllfidnifrf
tqagsevsallgripsavgyqptlatdmgtmqeritttkkgsitsvqaiyvpaddltdpa
pattfahldattvlsraiaelgiypavdpldstsri
Timeline for d1h8ed3: