Lineage for d1h8ed1 (1h8e D:358-475)

  1. Root: SCOP 1.67
  2. 349259Class a: All alpha proteins [46456] (202 folds)
  3. 357519Fold a.69: Left-handed superhelix [47916] (3 superfamilies)
    core: 4-5 helices; bundle; left-handed superhelix
  4. 357520Superfamily a.69.1: C-terminal domain of alpha and beta subunits of F1 ATP synthase [47917] (1 family) (S)
  5. 357521Family a.69.1.1: C-terminal domain of alpha and beta subunits of F1 ATP synthase [47918] (2 proteins)
  6. 357561Protein F1 ATP synthase beta subunit, domain 3 [88928] (4 species)
  7. 357564Species Cow (Bos taurus) [TaxId:9913] [88929] (10 PDB entries)
  8. 357568Domain d1h8ed1: 1h8e D:358-475 [60747]
    Other proteins in same PDB: d1h8ea1, d1h8ea2, d1h8ea3, d1h8eb1, d1h8eb2, d1h8eb3, d1h8ec1, d1h8ec2, d1h8ec3, d1h8ed2, d1h8ed3, d1h8ee2, d1h8ee3, d1h8ef2, d1h8ef3, d1h8eg_, d1h8eh_, d1h8ei_

Details for d1h8ed1

PDB Entry: 1h8e (more details), 2 Å

PDB Description: (adp.alf4)2(adp.so4) bovine f1-atpase (all three catalytic sites occupied)

SCOP Domain Sequences for d1h8ed1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h8ed1 a.69.1.1 (D:358-475) F1 ATP synthase beta subunit, domain 3 {Cow (Bos taurus)}
mdpnivgsehydvargvqkilqdykslqdiiailgmdelseedkltvsrarkiqrflsqp
fqvaevftghlgklvplketikgfqqilageydhlpeqafymvgpieeavakadklae

SCOP Domain Coordinates for d1h8ed1:

Click to download the PDB-style file with coordinates for d1h8ed1.
(The format of our PDB-style files is described here.)

Timeline for d1h8ed1: