Lineage for d1h8ec3 (1h8e C:95-379)

  1. Root: SCOP 1.61
  2. 172677Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 179162Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily)
  4. 179163Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (18 families) (S)
  5. 179955Family c.37.1.11: RecA protein-like (ATPase-domain) [52670] (7 proteins)
  6. 180008Protein Central domain of alpha and beta subunits of F1 ATP synthase [52678] (4 species)
  7. 180012Species Cow (Bos taurus) [TaxId:9913] [52679] (9 PDB entries)
  8. 180021Domain d1h8ec3: 1h8e C:95-379 [60746]
    Other proteins in same PDB: d1h8ea1, d1h8ea2, d1h8eb1, d1h8eb2, d1h8ec1, d1h8ec2, d1h8ed1, d1h8ed2, d1h8ee1, d1h8ee2, d1h8ef1, d1h8ef2, d1h8eg_, d1h8eh_, d1h8ei_

Details for d1h8ec3

PDB Entry: 1h8e (more details), 2 Å

PDB Description: (adp.alf4)2(adp.so4) bovine f1-atpase (all three catalytic sites occupied)

SCOP Domain Sequences for d1h8ec3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h8ec3 c.37.1.11 (C:95-379) Central domain of alpha and beta subunits of F1 ATP synthase {Cow (Bos taurus)}
vdvpvgeellgrvvdalgnaidgkgpigskarrrvglkapgiiprisvrepmqtgikavd
slvpigrgqreliigdrqtgktsiaidtiinqkrfndgtdekkklyciyvaigqkrstva
qlvkrltdadamkytivvsatasdaaplqylapysgcsmgeyfrdngkhaliiyddlskq
avayrqmslllrrppgreaypgdvfylhsrlleraakmndafgggsltalpvietqagdv
sayiptnvisitdgqifletelfykgirpainvglsvsrvgsaaq

SCOP Domain Coordinates for d1h8ec3:

Click to download the PDB-style file with coordinates for d1h8ec3.
(The format of our PDB-style files is described here.)

Timeline for d1h8ec3: