Lineage for d1h8ea2 (1h8e A:19-94)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 377221Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (3 superfamilies)
    barrel, closed; n=6, S=8; greek-key
  4. 377222Superfamily b.49.1: N-terminal domain of alpha and beta subunits of F1 ATP synthase [50615] (1 family) (S)
  5. 377223Family b.49.1.1: N-terminal domain of alpha and beta subunits of F1 ATP synthase [50616] (2 proteins)
    6 domains form a ring structure which contains a barrel, closed; n=24, S=24(?)
  6. 377224Protein F1 ATP synthase alpha subunit, domain 1 [88672] (4 species)
  7. 377227Species Cow (Bos taurus) [TaxId:9913] [88673] (10 PDB entries)
  8. 377231Domain d1h8ea2: 1h8e A:19-94 [60739]
    Other proteins in same PDB: d1h8ea1, d1h8ea3, d1h8eb1, d1h8eb3, d1h8ec1, d1h8ec3, d1h8ed1, d1h8ed2, d1h8ed3, d1h8ee1, d1h8ee2, d1h8ee3, d1h8ef1, d1h8ef2, d1h8ef3, d1h8eg_, d1h8eh_, d1h8ei_

Details for d1h8ea2

PDB Entry: 1h8e (more details), 2 Å

PDB Description: (adp.alf4)2(adp.so4) bovine f1-atpase (all three catalytic sites occupied)

SCOP Domain Sequences for d1h8ea2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h8ea2 b.49.1.1 (A:19-94) F1 ATP synthase alpha subunit, domain 1 {Cow (Bos taurus)}
adtsvdleetgrvlsigdgiarvhglrnvqaeemvefssglkgmslnlepdnvgvvvfgn
dklikegdivkrtgai

SCOP Domain Coordinates for d1h8ea2:

Click to download the PDB-style file with coordinates for d1h8ea2.
(The format of our PDB-style files is described here.)

Timeline for d1h8ea2: