Lineage for d1h8ba_ (1h8b A:)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 640657Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 640658Superfamily a.39.1: EF-hand [47473] (11 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 641256Family a.39.1.7: EF-hand modules in multidomain proteins [47547] (7 proteins)
  6. 641257Protein alpha-Actinin [63553] (1 species)
  7. 641258Species Human (Homo sapiens) [TaxId:9606] [63554] (1 PDB entry)
  8. 641259Domain d1h8ba_: 1h8b A: [60736]
    EF-hands 3&4 complexed with Z-repeat 7 from titin, chain B

Details for d1h8ba_

PDB Entry: 1h8b (more details)

PDB Description: ef-hands 3,4 from alpha-actinin / z-repeat 7 from titin
PDB Compounds: (A:) alpha-actinin 2, skeletal muscle isoform

SCOP Domain Sequences for d1h8ba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h8ba_ a.39.1.7 (A:) alpha-Actinin {Human (Homo sapiens) [TaxId: 9606]}
madtdtaeqviasfrilasdkpyilaeelrrelppdqaqycikrmpaysgpgsvpgaldy
aafssalygesdl

SCOP Domain Coordinates for d1h8ba_:

Click to download the PDB-style file with coordinates for d1h8ba_.
(The format of our PDB-style files is described here.)

Timeline for d1h8ba_: