![]() | Class a: All alpha proteins [46456] (258 folds) |
![]() | Fold a.39: EF Hand-like [47472] (4 superfamilies) core: 4 helices; array of 2 hairpins, opened |
![]() | Superfamily a.39.1: EF-hand [47473] (11 families) ![]() Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop |
![]() | Family a.39.1.7: EF-hand modules in multidomain proteins [47547] (7 proteins) |
![]() | Protein alpha-Actinin [63553] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [63554] (1 PDB entry) |
![]() | Domain d1h8ba_: 1h8b A: [60736] EF-hands 3&4 complexed with Z-repeat 7 from titin, chain B |
PDB Entry: 1h8b (more details)
SCOP Domain Sequences for d1h8ba_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1h8ba_ a.39.1.7 (A:) alpha-Actinin {Human (Homo sapiens) [TaxId: 9606]} madtdtaeqviasfrilasdkpyilaeelrrelppdqaqycikrmpaysgpgsvpgaldy aafssalygesdl
Timeline for d1h8ba_: