Lineage for d1h8ba_ (1h8b A:)

  1. Root: SCOP 1.57
  2. 43951Class a: All alpha proteins [46456] (144 folds)
  3. 47511Fold a.39: EF Hand-like [47472] (3 superfamilies)
  4. 47512Superfamily a.39.1: EF-hand [47473] (8 families) (S)
  5. 47807Family a.39.1.7: EF-hand modules in multidomain proteins [47547] (8 proteins)
  6. 47808Protein alpha-Actinin [63553] (1 species)
  7. 47809Species Human (Homo sapiens) [TaxId:9606] [63554] (1 PDB entry)
  8. 47810Domain d1h8ba_: 1h8b A: [60736]

Details for d1h8ba_

PDB Entry: 1h8b (more details)

PDB Description: ef-hands 3,4 from alpha-actinin / z-repeat 7 from titin

SCOP Domain Sequences for d1h8ba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h8ba_ a.39.1.7 (A:) alpha-Actinin {Human (Homo sapiens)}
madtdtaeqviasfrilasdkpyilaeelrrelppdqaqycikrmpaysgpgsvpgaldy
aafssalygesdl

SCOP Domain Coordinates for d1h8ba_:

Click to download the PDB-style file with coordinates for d1h8ba_.
(The format of our PDB-style files is described here.)

Timeline for d1h8ba_: