Lineage for d1h7zc_ (1h7z C:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2048516Fold b.21: Virus attachment protein globular domain [49834] (1 superfamily)
    sandwich, 10 strands in 2 sheets; greek-key
  4. 2048517Superfamily b.21.1: Virus attachment protein globular domain [49835] (4 families) (S)
  5. 2048518Family b.21.1.1: Adenovirus fiber protein "knob" domain [49836] (2 proteins)
    automatically mapped to Pfam PF00541
  6. 2048519Protein Adenovirus fiber protein "knob" domain [49837] (12 species)
  7. 2048603Species Human adenovirus type 3 [TaxId:45659] [63720] (2 PDB entries)
  8. 2048606Domain d1h7zc_: 1h7z C: [60735]
    complexed with so4

Details for d1h7zc_

PDB Entry: 1h7z (more details), 1.6 Å

PDB Description: adenovirus ad3 fibre head
PDB Compounds: (C:) adenovirus fibre protein

SCOPe Domain Sequences for d1h7zc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h7zc_ b.21.1.1 (C:) Adenovirus fiber protein "knob" domain {Human adenovirus type 3 [TaxId: 45659]}
knntlwtgpkpeanciieygkqnpdskltlilvknggivngyvtlmgasdyvntlfknkn
vsinvelyfdatghilpdssslktdlelkykqtadfsargfmpsttaypfvlpnagthne
nyifgqcyykasdgalfplevtvmlnkrlpdsrtsyvmtflwslnaglapettqatlits
pftfsyiredd

SCOPe Domain Coordinates for d1h7zc_:

Click to download the PDB-style file with coordinates for d1h7zc_.
(The format of our PDB-style files is described here.)

Timeline for d1h7zc_: