Lineage for d1h7zb_ (1h7z B:)
- Root: SCOP 1.57
Class b: All beta proteins [48724] (104 folds) 
Fold b.21: Adenovirus fiber protein head domain (knob domain) [49834] (1 superfamily) Superfamily b.21.1: Adenovirus fiber protein head domain (knob domain) [49835] (1 family) 
Family b.21.1.1: Adenovirus fiber protein head domain (knob domain) [49836] (1 protein) Protein Adenovirus fiber protein head domain (knob domain) [49837] (4 species) 
Species Human adenovirus type 3 [TaxId:45659] [63720] (1 PDB entry) 
Domain d1h7zb_: 1h7z B: [60734]
Details for d1h7zb_
PDB Entry: 1h7z (more details), 1.6 Å
PDB Description: adenovirus ad3 fibre head
SCOP Domain Sequences for d1h7zb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1h7zb_ b.21.1.1 (B:) Adenovirus fiber protein head domain (knob domain) {Human adenovirus type 3}
knntlwtgpkpeanciieygkqnpdskltlilvknggivngyvtlmgasdyvntlfknkn
vsinvelyfdatghilpdssslktdlelkykqtadfsargfmpsttaypfvlpnagthne
nyifgqcyykasdgalfplevtvmlnkrlpdsrtsyvmtflwslnaglapettqatlits
pftfsyiredd
SCOP Domain Coordinates for d1h7zb_:
Click to download the PDB-style file with coordinates for d1h7zb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1h7zb_:
- d1h7zb_ is new in SCOP 1.57
- d1h7zb_ appears in SCOP 1.59
- d1h7zb_ appears in the current release, SCOPe 2.08
View in 3D
