Lineage for d1h7ya_ (1h7y A:)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 64119Fold b.88: Mss4-like [51315] (1 superfamily)
  4. 64120Superfamily b.88.1: Mss4-like [51316] (2 families) (S)
  5. 64128Family b.88.1.2: Translationally controlled tumor-associated protein tctp, p23fyp [63873] (1 protein)
  6. 64129Protein Translationally controlled tumor-associated protein tctp, p23fyp [63874] (1 species)
  7. 64130Species Fission yeast (Schizosaccharomyces pombe) [TaxId:4896] [63875] (2 PDB entries)
  8. 64132Domain d1h7ya_: 1h7y A: [60732]

Details for d1h7ya_

PDB Entry: 1h7y (more details)

PDB Description: translationally controlled tumor-associated protein p23fyp from schizosaccharomyces pombe

SCOP Domain Sequences for d1h7ya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h7ya_ b.88.1.2 (A:) Translationally controlled tumor-associated protein tctp, p23fyp {Fission yeast (Schizosaccharomyces pombe)}
mllykdvisgdelvsdaydlkevddivyeadcqmvtvkqggdvdiganpsaedaeenaee
gtetvnnlvysfrlsptsfdkksymsyikgymkaikarlqesnpervpvfeknaigfvkk
ilanfkdydfyigesmdpdamvvlmnyredgitpymiffkdglvsekf

SCOP Domain Coordinates for d1h7ya_:

Click to download the PDB-style file with coordinates for d1h7ya_.
(The format of our PDB-style files is described here.)

Timeline for d1h7ya_: