SCOP 1.59: Domain d1h7tb_: 1h7t B:

Lineage for d1h7tb_ (1h7t B:)

1. Root: SCOP 1.59

2. Class c: Alpha and beta proteins (a/b) [51349] (113 folds)

3. Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily)

4. Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (11 families)

5. Family c.68.1.13: Cytidylytransferase [68901] (3 proteins)

6. Protein CMP:2-keto-3-deoxy-manno-octonic acid (CMP-KDO)synthetase, KdsB [64143] (1 species)

7. Species Escherichia coli [TaxId:562] [64144] (8 PDB entries)

8. Domain d1h7tb_: 1h7t B: [60731]

Details for d1h7tb_

PDB Entry: 1h7t, 2.48 Å

PDB Description: the structure of cmp:2-keto-3-deoxy-manno-octonic acid synthetase and of its complexes with substrates and substrate analogues, here complex with cmp-neuac

SCOP Domain Sequences for d1h7tb_:

Sequence; same for both SEQRES and ATOM records:

>d1h7tb_ c.68.1.13 (B:) CMP:2-keto-3-deoxy-manno-octonic acid (CMP-KDO)synthetase, KdsB {Escherichia coli}
skaviviparygssrlpgkplldivgkpmiqhvyeralqvagvaevwvatddprveqavq
afggkaimtrndhesgtdrlvevmhkveadiyinlqgdepmirprdvetllqgmrddpal
pvatlchaisaaeaaepstvkvvvntrqdalyfsrspipyprnaekarylkhvgiyayrr
dvlqnysqlpesmpeqaesleqlrlmnaginirtfevaatgpgvdtpaclekvralmaqe
l

Timeline for d1h7tb_:

• d1h7tb_ first appeared in SCOP 1.57
  
• d1h7tb_ appears in SCOP 1.61
  
• d1h7tb_ appears in the current release, SCOPe 2.08