Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.10: Aldolase [51569] (9 families) Common fold covers whole protein structure |
Family c.1.10.3: 5-aminolaevulinate dehydratase, ALAD (porphobilinogen synthase) [51594] (2 proteins) hybrid of classes I and II aldolase automatically mapped to Pfam PF00490 |
Protein 5-aminolaevulinate dehydratase, ALAD (porphobilinogen synthase) [51595] (5 species) |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [51596] (12 PDB entries) |
Domain d1h7ra_: 1h7r A: [60729] complexed with shu, zn |
PDB Entry: 1h7r (more details), 2 Å
SCOPe Domain Sequences for d1h7ra_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1h7ra_ c.1.10.3 (A:) 5-aminolaevulinate dehydratase, ALAD (porphobilinogen synthase) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} mhtaefletepteissvlaggynhpllrqwqserqltknmlifplfisdnpddfteidsl pninrigvnrlkdylkplvakglrsvilfgvplipgtkdpvgtaaddpagpviqgikfir eyfpelyiicdvclceytshghcgvlyddgtinrersvsrlaavavnyakagahcvapsd midgrirdikrglinanlahktfvlsyaakfsgnlygpfrdaacsapsngdrkcyqlppa grglarralerdmsegadgiivkpstfyldimrdaseickdlpicayhvsgeyamlhaaa ekgvvdlktiafeshqgflragarliitylapefldwldeen
Timeline for d1h7ra_: