Lineage for d1h7oa_ (1h7o A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1815292Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1821671Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 1822493Family c.1.10.3: 5-aminolaevulinate dehydratase, ALAD (porphobilinogen synthase) [51594] (2 proteins)
    hybrid of classes I and II aldolase
    automatically mapped to Pfam PF00490
  6. 1822494Protein 5-aminolaevulinate dehydratase, ALAD (porphobilinogen synthase) [51595] (5 species)
  7. 1822495Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [51596] (11 PDB entries)
  8. 1822500Domain d1h7oa_: 1h7o A: [60727]
    complexed with dav, zn

Details for d1h7oa_

PDB Entry: 1h7o (more details), 1.75 Å

PDB Description: schiff-base complex of yeast 5-aminolaevulinic acid dehydratase with 5-aminolaevulinic acid at 1.7 a resolution
PDB Compounds: (A:) 5-aminolaevulinic acid dehydratase

SCOPe Domain Sequences for d1h7oa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h7oa_ c.1.10.3 (A:) 5-aminolaevulinate dehydratase, ALAD (porphobilinogen synthase) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
mhtaefletepteissvlaggynhpllrqwqserqltknmlifplfisdnpddfteidsl
pninrigvnrlkdylkplvakglrsvilfgvplipgtkdpvgtaaddpagpviqgikfir
eyfpelyiicdvclceytshghcgvlyddgtinrersvsrlaavavnyakagahcvapsd
midgrirdikrglinanlahktfvlsyaakfsgnlygpfrdaacsapsngdrkcyqlppa
grglarralerdmsegadgiivkpstfyldimrdaseickdlpicayhvsgeyamlhaaa
ekgvvdlktiafeshqgflragarliitylapefldwldee

SCOPe Domain Coordinates for d1h7oa_:

Click to download the PDB-style file with coordinates for d1h7oa_.
(The format of our PDB-style files is described here.)

Timeline for d1h7oa_: