Lineage for d1h7oa_ (1h7o A:)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 64292Fold c.1: TIM beta/alpha-barrel [51350] (24 superfamilies)
  4. 65283Superfamily c.1.10: Aldolase [51569] (4 families) (S)
  5. 65436Family c.1.10.3: 5-aminolaevulinate dehydratase, ALAD (porphobilinogen synthase) [51594] (1 protein)
  6. 65437Protein 5-aminolaevulinate dehydratase, ALAD (porphobilinogen synthase) [51595] (4 species)
  7. 65438Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [51596] (10 PDB entries)
  8. 65442Domain d1h7oa_: 1h7o A: [60727]

Details for d1h7oa_

PDB Entry: 1h7o (more details), 1.75 Å

PDB Description: schiff-base complex of yeast 5-aminolaevulinic acid dehydratase with 5-aminolaevulinic acid at 1.7 a resolution

SCOP Domain Sequences for d1h7oa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h7oa_ c.1.10.3 (A:) 5-aminolaevulinate dehydratase, ALAD (porphobilinogen synthase) {Baker's yeast (Saccharomyces cerevisiae)}
mhtaefletepteissvlaggynhpllrqwqserqltknmlifplfisdnpddfteidsl
pninrigvnrlkdylkplvakglrsvilfgvplipgtkdpvgtaaddpagpviqgikfir
eyfpelyiicdvclceytshghcgvlyddgtinrersvsrlaavavnyakagahcvapsd
midgrirdikrglinanlahktfvlsyaakfsgnlygpfrdaacsapsngdrkcyqlppa
grglarralerdmsegadgiivkpstfyldimrdaseickdlpicayhvsgeyamlhaaa
ekgvvdlktiafeshqgflragarliitylapefldwldee

SCOP Domain Coordinates for d1h7oa_:

Click to download the PDB-style file with coordinates for d1h7oa_.
(The format of our PDB-style files is described here.)

Timeline for d1h7oa_: