Lineage for d1h7ia_ (1h7i A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2311272Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies)
    core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down
  4. 2311273Superfamily a.24.1: Apolipoprotein [47162] (1 family) (S)
  5. 2311274Family a.24.1.1: Apolipoprotein [47163] (1 protein)
    Can exist in a coiled-coil oligomeric form, see PDB entry 1AV1
    family may also include the five-helical bundle protein Apolipophorin-III
  6. 2311275Protein Apolipoprotein E [88703] (3 species)
  7. 2311279Species Human (Homo sapiens), E3 [TaxId:9606] [47165] (7 PDB entries)
  8. 2311281Domain d1h7ia_: 1h7i A: [60725]
    mutant

Details for d1h7ia_

PDB Entry: 1h7i (more details), 1.9 Å

PDB Description: apolipoprotein e3 22kd fragment lys146gln mutant
PDB Compounds: (A:) apolipoprotein e

SCOPe Domain Sequences for d1h7ia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h7ia_ a.24.1.1 (A:) Apolipoprotein E {Human (Homo sapiens), E3 [TaxId: 9606]}
gqrwelalgrfwdylrwvqtlseqvqeellssqvtqelralmdetmkelkaykseleeql
tpvaeetrarlskelqaaqarlgadmedvcgrlvqyrgevqamlgqsteelrvrlashlr
klrqrllrdaddlqkrlavy

SCOPe Domain Coordinates for d1h7ia_:

Click to download the PDB-style file with coordinates for d1h7ia_.
(The format of our PDB-style files is described here.)

Timeline for d1h7ia_: