SCOPe 2.06: Domain d1h7hb_: 1h7h B:

Lineage for d1h7hb_ (1h7h B:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest

4. Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (20 families)

5. Family c.68.1.13: Cytidylytransferase [68901] (7 proteins)

6. Protein CMP:2-keto-3-deoxy-manno-octonic acid (CMP-KDO)synthetase [64143] (3 species)

7. Species Escherichia coli, KpsU [TaxId:562] [64144] (8 PDB entries)
   capsule-specific enzyme

8. Domain d1h7hb_: 1h7h B: [60724]
   complexed with cdp

Details for d1h7hb_

PDB Entry: 1h7h, 2.3 Å

PDB Description: the structure of cmp:2-keto-3-deoxy-manno-octonic acid synthetase and of its complexes with substrates and substrate analogues, cdp complex

PDB Compounds: (B:) 3-deoxy-manno-octulosonate cytidylyltransferase

SCOPe Domain Sequences for d1h7hb_:

Sequence; same for both SEQRES and ATOM records:

>d1h7hb_ c.68.1.13 (B:) CMP:2-keto-3-deoxy-manno-octonic acid (CMP-KDO)synthetase {Escherichia coli, KpsU [TaxId: 562]}
skaviviparygssrlpgkplldivgkpmiqhvyeralqvagvaevwvatddprveqavq
afggkaimtrndhesgtdrlvevmhkveadiyinlqgdepmirprdvetllqgmrddpal
pvatlchaisaaeaaepstvkvvvntrqdalyfsrspipyprnaekarylkhvgiyayrr
dvlqnysqlpesmpeqaesleqlrlmnaginirtfevaatgpgvdtpaclekvralmaqe
l

Timeline for d1h7hb_:

• d1h7hb_ first appeared in SCOP 1.57
  
• d1h7hb_ appears in SCOPe 2.05
  
• d1h7hb_ appears in SCOPe 2.07
  
• d1h7hb_ appears in the current release, SCOPe 2.08