Lineage for d1h7ea_ (1h7e A:)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 73507Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily)
  4. 73508Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (12 families) (S)
  5. 73636Family c.68.1.12: CMP:2-keto-3-deoxy-manno-octonic acid (CMP-KDO)synthetase, KdsB [64142] (1 protein)
  6. 73637Protein CMP:2-keto-3-deoxy-manno-octonic acid (CMP-KDO)synthetase, KdsB [64143] (1 species)
  7. 73638Species Escherichia coli [TaxId:562] [64144] (6 PDB entries)
  8. 73639Domain d1h7ea_: 1h7e A: [60717]

Details for d1h7ea_

PDB Entry: 1h7e (more details), 1.83 Å

PDB Description: the structure of cmp:2-keto-3-deoxy-manno-octonic acid synthetase and of its complexes with substrates and substrate analogues, apo-enzyme

SCOP Domain Sequences for d1h7ea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h7ea_ c.68.1.12 (A:) CMP:2-keto-3-deoxy-manno-octonic acid (CMP-KDO)synthetase, KdsB {Escherichia coli}
skaviviparygssrlpgkplldivgkpmiqhvyeralqvagvaevwvatddprveqavq
afggkaimtrndhesgtdrlvevmhkveadiyinlqgdepmirprdvetllqgmrddpal
pvatlchaisaaeaaepstvkvvvntrqdalyfsrspipyprnaekarylkhvgiyayrr
dvlqnysqlpesmpeqaesleqlrlmnaginirtfevaatgpgvdtpaclekvralmaqe
laena

SCOP Domain Coordinates for d1h7ea_:

Click to download the PDB-style file with coordinates for d1h7ea_.
(The format of our PDB-style files is described here.)

Timeline for d1h7ea_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1h7eb_