Lineage for d1h7ea_ (1h7e A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2898275Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest
  4. 2898276Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (20 families) (S)
  5. 2898986Family c.68.1.13: Cytidylytransferase [68901] (7 proteins)
  6. 2899041Protein CMP:2-keto-3-deoxy-manno-octonic acid (CMP-KDO)synthetase [64143] (3 species)
  7. 2899047Species Escherichia coli, KpsU [TaxId:562] [64144] (8 PDB entries)
    capsule-specific enzyme
  8. 2899054Domain d1h7ea_: 1h7e A: [60717]

Details for d1h7ea_

PDB Entry: 1h7e (more details), 1.83 Å

PDB Description: the structure of cmp:2-keto-3-deoxy-manno-octonic acid synthetase and of its complexes with substrates and substrate analogues, apo-enzyme
PDB Compounds: (A:) 3-deoxy-manno-octulosonate cytidylyltransferase

SCOPe Domain Sequences for d1h7ea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h7ea_ c.68.1.13 (A:) CMP:2-keto-3-deoxy-manno-octonic acid (CMP-KDO)synthetase {Escherichia coli, KpsU [TaxId: 562]}
skaviviparygssrlpgkplldivgkpmiqhvyeralqvagvaevwvatddprveqavq
afggkaimtrndhesgtdrlvevmhkveadiyinlqgdepmirprdvetllqgmrddpal
pvatlchaisaaeaaepstvkvvvntrqdalyfsrspipyprnaekarylkhvgiyayrr
dvlqnysqlpesmpeqaesleqlrlmnaginirtfevaatgpgvdtpaclekvralmaqe
laena

SCOPe Domain Coordinates for d1h7ea_:

Click to download the PDB-style file with coordinates for d1h7ea_.
(The format of our PDB-style files is described here.)

Timeline for d1h7ea_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1h7eb_