Lineage for d1h73a2 (1h73 A:168-300)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2555938Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2561426Superfamily d.58.26: GHMP Kinase, C-terminal domain [55060] (8 families) (S)
    common fold is elaborated with additional secondary structures
  5. 2561427Family d.58.26.1: Homoserine kinase [55061] (1 protein)
  6. 2561428Protein Homoserine kinase [55062] (1 species)
  7. 2561429Species Methanococcus jannaschii [TaxId:2190] [55063] (5 PDB entries)
  8. 2561431Domain d1h73a2: 1h73 A:168-300 [60715]
    Other proteins in same PDB: d1h73a1
    complexed with anp, thr

Details for d1h73a2

PDB Entry: 1h73 (more details), 2 Å

PDB Description: crystal structure of homoserine kinase complexed with threonine
PDB Compounds: (A:) homoserine kinase

SCOPe Domain Sequences for d1h73a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h73a2 d.58.26.1 (A:168-300) Homoserine kinase {Methanococcus jannaschii [TaxId: 2190]}
fkldiliaipnisintkeareilpkavglkdlvnnvgkacgmvyalynkdkslfgrymms
dkviepvrgklipnyfkikeevkdkvygitisgsgpsiiafpkeefidevenilrdyyen
tirtevgkgvevv

SCOPe Domain Coordinates for d1h73a2:

Click to download the PDB-style file with coordinates for d1h73a2.
(The format of our PDB-style files is described here.)

Timeline for d1h73a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1h73a1