Lineage for d1h73a1 (1h73 A:5-167)

  1. Root: SCOP 1.65
  2. 323018Class d: Alpha and beta proteins (a+b) [53931] (234 folds)
  3. 325230Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
    core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover
  4. 325231Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (7 families) (S)
  5. 325331Family d.14.1.5: GHMP Kinase, N-terminal domain [54232] (5 proteins)
  6. 325335Protein Homoserine kinase [54233] (1 species)
  7. 325336Species Archaeon Methanococcus jannaschii [TaxId:2190] [54234] (5 PDB entries)
  8. 325338Domain d1h73a1: 1h73 A:5-167 [60714]
    Other proteins in same PDB: d1h73a2
    complexed with anp, thr

Details for d1h73a1

PDB Entry: 1h73 (more details), 2 Å

PDB Description: crystal structure of homoserine kinase complexed with threonine

SCOP Domain Sequences for d1h73a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h73a1 d.14.1.5 (A:5-167) Homoserine kinase {Archaeon Methanococcus jannaschii}
mkvrvkapctsanlgvgfdvfglclkepydvieveaiddkeiiievddkniptdpdknva
givakkmiddfnigkgvkitikkgvkagsglgssaassagtayainelfklnldklklvd
yasygelassgakhadnvapaifggftmvtnyeplevlhipid

SCOP Domain Coordinates for d1h73a1:

Click to download the PDB-style file with coordinates for d1h73a1.
(The format of our PDB-style files is described here.)

Timeline for d1h73a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1h73a2