Lineage for d1h72c2 (1h72 C:168-300)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2192663Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2197530Superfamily d.58.26: GHMP Kinase, C-terminal domain [55060] (8 families) (S)
    common fold is elaborated with additional secondary structures
  5. 2197531Family d.58.26.1: Homoserine kinase [55061] (1 protein)
  6. 2197532Protein Homoserine kinase [55062] (1 species)
  7. 2197533Species Methanococcus jannaschii [TaxId:2190] [55063] (5 PDB entries)
  8. 2197534Domain d1h72c2: 1h72 C:168-300 [60713]
    Other proteins in same PDB: d1h72c1
    complexed with anp, hse, trs

Details for d1h72c2

PDB Entry: 1h72 (more details), 1.8 Å

PDB Description: crystal structure of homoserine kinase complexed with hse
PDB Compounds: (C:) homoserine kinase

SCOPe Domain Sequences for d1h72c2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h72c2 d.58.26.1 (C:168-300) Homoserine kinase {Methanococcus jannaschii [TaxId: 2190]}
fkldiliaipnisintkeareilpkavglkdlvnnvgkacgmvyalynkdkslfgrymms
dkviepvrgklipnyfkikeevkdkvygitisgsgpsiiafpkeefidevenilrdyyen
tirtevgkgvevv

SCOPe Domain Coordinates for d1h72c2:

Click to download the PDB-style file with coordinates for d1h72c2.
(The format of our PDB-style files is described here.)

Timeline for d1h72c2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1h72c1