Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.26: GHMP Kinase, C-terminal domain [55060] (8 families) common fold is elaborated with additional secondary structures |
Family d.58.26.1: Homoserine kinase [55061] (1 protein) |
Protein Homoserine kinase [55062] (1 species) |
Species Methanococcus jannaschii [TaxId:2190] [55063] (5 PDB entries) |
Domain d1h72c2: 1h72 C:168-300 [60713] Other proteins in same PDB: d1h72c1 complexed with anp, hse, trs |
PDB Entry: 1h72 (more details), 1.8 Å
SCOPe Domain Sequences for d1h72c2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1h72c2 d.58.26.1 (C:168-300) Homoserine kinase {Methanococcus jannaschii [TaxId: 2190]} fkldiliaipnisintkeareilpkavglkdlvnnvgkacgmvyalynkdkslfgrymms dkviepvrgklipnyfkikeevkdkvygitisgsgpsiiafpkeefidevenilrdyyen tirtevgkgvevv
Timeline for d1h72c2: