SCOP 1.57: Domain d1h72c2: 1h72 C:168-300

Lineage for d1h72c2 (1h72 C:168-300)

1. Root: SCOP 1.57

2. Class d: Alpha and beta proteins (a+b) [53931] (194 folds)

3. Fold d.58: Ferredoxin-like [54861] (36 superfamilies)

4. Superfamily d.58.26: GHMP Kinase [55060] (2 families)

5. Family d.58.26.1: Homoserine kinase, C-terminal domain [55061] (1 protein)

6. Protein Homoserine kinase, C-terminal domain [55062] (1 species)

7. Species Archaeon Methanococcus jannaschii [TaxId:2190] [55063] (4 PDB entries)

8. Domain d1h72c2: 1h72 C:168-300 [60713]
   Other proteins in same PDB: d1h72c1

Details for d1h72c2

PDB Entry: 1h72, 1.8 Å

PDB Description: crystal structure of homoserine kinase complexed with hse

SCOP Domain Sequences for d1h72c2:

Sequence; same for both SEQRES and ATOM records:

>d1h72c2 d.58.26.1 (C:168-300) Homoserine kinase, C-terminal domain {Archaeon Methanococcus jannaschii}
fkldiliaipnisintkeareilpkavglkdlvnnvgkacgmvyalynkdkslfgrymms
dkviepvrgklipnyfkikeevkdkvygitisgsgpsiiafpkeefidevenilrdyyen
tirtevgkgvevv

Timeline for d1h72c2:

• d1h72c2 is new in SCOP 1.57
  
• d1h72c2 appears in SCOP 1.59
  
• d1h72c2 appears in the current release, SCOPe 2.08