Lineage for d1h72c2 (1h72 C:168-300)
- Root: SCOPe 2.08
Class d: Alpha and beta proteins (a+b) [53931] (396 folds) 
Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
Superfamily d.58.26: GHMP Kinase, C-terminal domain [55060] (8 families) 
common fold is elaborated with additional secondary structures
Family d.58.26.1: Homoserine kinase [55061] (1 protein) Protein Homoserine kinase [55062] (1 species) Species Methanococcus jannaschii [TaxId:2190] [55063] (5 PDB entries) 
Domain d1h72c2: 1h72 C:168-300 [60713]
Other proteins in same PDB: d1h72c1
complexed with anp, hse, trs
Details for d1h72c2
PDB Entry: 1h72 (more details), 1.8 Å
PDB Description: crystal structure of homoserine kinase complexed with hse
PDB Compounds: (C:) homoserine kinaseSCOPe Domain Sequences for d1h72c2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1h72c2 d.58.26.1 (C:168-300) Homoserine kinase {Methanococcus jannaschii [TaxId: 2190]}
fkldiliaipnisintkeareilpkavglkdlvnnvgkacgmvyalynkdkslfgrymms
dkviepvrgklipnyfkikeevkdkvygitisgsgpsiiafpkeefidevenilrdyyen
tirtevgkgvevv
SCOPe Domain Coordinates for d1h72c2:
Click to download the PDB-style file with coordinates for d1h72c2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1h72c2:
- d1h72c2 first appeared in SCOP 1.57
- d1h72c2 appears in SCOPe 2.07
View in 3D
