Lineage for d1h70a_ (1h70 A:)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1217588Fold d.126: Pentein, beta/alpha-propeller [55908] (1 superfamily)
    duplication: composed of 5 alpha-beta(2)-alpha-beta units arranged around pseudo fivefold axis
  4. 1217589Superfamily d.126.1: Pentein [55909] (8 families) (S)
  5. 1217615Family d.126.1.3: Dimethylarginine dimethylaminohydrolase DDAH [64380] (1 protein)
    functionally related to the amidinotransferase, similar active sites
  6. 1217616Protein Dimethylarginine dimethylaminohydrolase DDAH [64381] (1 species)
  7. 1217617Species Pseudomonas aeruginosa [TaxId:287] [64382] (3 PDB entries)
  8. 1217618Domain d1h70a_: 1h70 A: [60711]
    complexed with cir; mutant

Details for d1h70a_

PDB Entry: 1h70 (more details), 1.8 Å

PDB Description: ddah from pseudomonas aeruginosa. c249s mutant complexed with citrulline
PDB Compounds: (A:) ng, ng-dimethylarginine dimethylaminohydrolase

SCOPe Domain Sequences for d1h70a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h70a_ d.126.1.3 (A:) Dimethylarginine dimethylaminohydrolase DDAH {Pseudomonas aeruginosa [TaxId: 287]}
fmfkhiiartparslvdgltsshlgkpdyakaleqhnayiralqtcdvditllppderfp
dsvfvedpvlctsrcaiitrpgaesrrgeteiieetvqrfypgkverieapgtveagdim
mvgdhfyigesartnaegarqmiailekhglsgsvvrlekvlhlktglaylehnnllaag
efvskpefqdfniieipeeesyaanciwvnervimpagyprtrekiarlgyrvievdtse
yrkidggvssmslrf

SCOPe Domain Coordinates for d1h70a_:

Click to download the PDB-style file with coordinates for d1h70a_.
(The format of our PDB-style files is described here.)

Timeline for d1h70a_: